Package: motifr 1.0.0

motifr: Motif Analysis in Multi-Level Networks
Tools for motif analysis in multi-level networks. Multi-level networks combine multiple networks in one, e.g. social-ecological networks. Motifs are small configurations of nodes and edges (subgraphs) occurring in networks. 'motifr' can visualize multi-level networks, count multi-level network motifs and compare motif occurrences to baseline models. It also identifies contributions of existing or potential edges to motifs to find critical or missing edges. The package is in many parts an R wrapper for the excellent 'SESMotifAnalyser' 'Python' package written by Tim Seppelt.
Authors:
motifr_1.0.0.tar.gz
motifr_1.0.0.zip(r-4.5)motifr_1.0.0.zip(r-4.4)motifr_1.0.0.zip(r-4.3)
motifr_1.0.0.tgz(r-4.5-any)motifr_1.0.0.tgz(r-4.4-any)motifr_1.0.0.tgz(r-4.3-any)
motifr_1.0.0.tar.gz(r-4.5-noble)motifr_1.0.0.tar.gz(r-4.4-noble)
motifr_1.0.0.tgz(r-4.4-emscripten)motifr_1.0.0.tgz(r-4.3-emscripten)
motifr.pdf |motifr.html✨
motifr/json (API)
NEWS
# Install 'motifr' in R: |
install.packages('motifr', repos = c('https://marioangst.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/marioangst/motifr/issues
Pkgdown site:https://marioangst.github.io
- directed_dummy_net - Two-level directed network dummy example
- dummy_net - Three-level network dummy example
- large_directed_dummy_net - Large two-level directed network dummy example
- ml_net - Two-level network example
- tidygraph_dummy_net - Two-level tidygraph network example
Last updated 4 years agofrom:5c7b65acfc. Checks:9 OK. Indexed: yes.
Target | Result | Latest binary |
---|---|---|
Doc / Vignettes | OK | Mar 15 2025 |
R-4.5-win | OK | Mar 15 2025 |
R-4.5-mac | OK | Mar 15 2025 |
R-4.5-linux | OK | Mar 15 2025 |
R-4.4-win | OK | Mar 15 2025 |
R-4.4-mac | OK | Mar 15 2025 |
R-4.4-linux | OK | Mar 15 2025 |
R-4.3-win | OK | Mar 15 2025 |
R-4.3-mac | OK | Mar 15 2025 |
Exports:compare_to_baselinecount_motifscritical_dyadsedge_contributionexemplify_motifexplore_motifsidentify_gapsinduced_level_subgraphis.directedlist_motifsmotif_summarymotifs_distributionplot_critical_dyadsplot_gapsplot_mnetshow_motifsimulate_baselinesupported_classessupported_signaturesto_py_graphupdate_motifr
Dependencies:base64encbslibcachemclicodacolorspacecommonmarkcpp11crayondigestdplyrfansifarverfastmapfontawesomefsgenericsggforceggplot2ggraphggrepelgluegraphlayoutsgridExtragtableherehtmltoolshttpuvigraphintergraphisobandjquerylibjsonlitelabelinglaterlatticelifecyclemagrittrMASSMatrixmemoisemgcvmimemunsellnetworknlmepillarpkgconfigplyrpngpolyclippromisespurrrR6rappdirsRColorBrewerRcppRcppArmadilloRcppEigenRcppTOMLreshape2reticulaterlangrprojrootsassscalesshinysourcetoolsstatnet.commonstringistringrsystemfontstibbletidygraphtidyrtidyselecttweenrutf8vctrsviridisviridisLitewithrxtable